Loading...
Search
> Stéphane Legrand00:00
00:00 / 00:00
Toronto, Canada - Timelapse - Nathan Phillips Square
Clip ID 631731
Creator Stéphane Legrand
Clearance
Proxy
Add to
Share
Add to Review Link
Select Your License
$ -
prores | 25fps | 4096x2304 | 1.65 GB
Per clip rates are for 20 seconds of final usage. If you are using more then 20 seconds or need a different file format or have questions about clearances contact us
Description
4K Timelapse Sequence of Toronto, Canada - Nathan Phillips Square
Credits
Stéphane Legrand Photography
Keywords
4kanglearchesarchitectureartbluebuildingcanadacanadiancentercentrecitycity hallcityscapecloudcloudyconcertscouncilcurveddaydestinationdowntownexhibitionfountaingtahallhighrisehotlandmarklunchmayormodernnathannathan phillips squarenewoldontariooutdoorovalpeoplephillipspoolreflectionrelaxsellshowsightsightseeingskyskyscrapersquarestrollsummersunsunnytentstorontotourtourismtowertowntravelurbanvacationwalkwaterwidewide angle
Related Footage
1094243 - High aerial descending towards Odessa Ukraine National Theater of Ballet 4K
1094243 - High aerial descending towards Odessa Ukraine National Theater of Ballet 4K
00:00:23 Cleared
Jared Cook
1094246 - Aerial pull back and wrap around statue on Odessa National Theater 4K
1094246 - Aerial pull back and wrap around statue on Odessa National Theater 4K
00:00:19 Cleared
Jared Cook
1094247 - Flyaway shot from statue on top of Odessa Ukraine National Academic Theater 4K
1094247 - Flyaway shot from statue on top of Odessa Ukraine National Academic Theater 4K
00:00:13 Cleared
Jared Cook
1094241 - Right to left aerial move across Odessa Ukraine National Theater with birds 4K
1094241 - Right to left aerial move across Odessa Ukraine National Theater with birds 4K
00:00:31 Cleared
Jared Cook
368362 - Arc de Triumphe (Triumph Archway) 1
368362 - Arc de Triumphe (Triumph Archway) 1
00:00:13 Cleared
Mystery Box | Digital Cinema Co.
982273 - Time-lapse panoramic view of the Sheikh Zayed Grand Mosque in Abu Dhabi
982273 - Time-lapse panoramic view of the Sheikh Zayed Grand Mosque in Abu Dhabi
00:00:07 Cleared
Timelapse4K
717305 - 1960: tourists feed pigeons in a square in front of a building with paintings over its arches VENICE
717305 - 1960: tourists feed pigeons in a square in front of a building with paintings over its arches VENICE
00:00:08 Not Cleared
Home Movie Archive
719392 - 1962: man made waterfall and fountain with statues ITALY
719392 - 1962: man made waterfall and fountain with statues ITALY
00:00:10 Not Cleared
Home Movie Archive