Loading...
Search
> Tyler Fairbank00:00
00:00 / 00:00
Sunny Vineyard Time Lapse - 8K
Clip ID 766866
Creator Tyler Fairbank
Clearance
Proxy
Add to
Share
Add to Review Link
Select Your License
$ -
prores | 24fps | 7680x4320 | 5.09 GB
Per clip rates are for 20 seconds of final usage. If you are using more then 20 seconds or need a different file format or have questions about clearances contact us
Description
A timelapse of a New England vineyard.
Credits
Tyler Fairbank
Keywords
timelapsehyperlapsetimelapse photographytimelapse videotimelapse shottimelapse 4ktimelapsedtimelapse movementtime-lapsetime lapse footagetime-lapstime lapsetime-lapse photographystop motionflow motionvineyardgrape vinewinegrapesgrapenew englandwine tastingcommon grape vinewinemakingvineyardsvineyard hillscommercialwinemakerwinemakersrowrowssunnycloudsgreendaylightpretty8k8k resolutionproductionwine industryindustrywinemaking processwinemaking agriculturevinesvine
Related Footage
1029706 - Bogart
1029706 - Bogart
00:00:06 Cleared
Arran Alps
1003136 - Waterfront Park Fountain Hyperlapse at Night (5K)
1003136 - Waterfront Park Fountain Hyperlapse at Night (5K)
00:00:05 Cleared
vivemedia
410847 - Bath Hyperlapse sequence. Queens Sq, Parade Gardens, Victoria Park, Prior Park
410847 - Bath Hyperlapse sequence. Queens Sq, Parade Gardens, Victoria Park, Prior Park
00:00:13 Cleared
JackFisher
1029700 - Beaumont
1029700 - Beaumont
00:00:12 Cleared
Arran Alps
766819 - Cruise Ship Sunset Timelapse - 8K
766819 - Cruise Ship Sunset Timelapse - 8K
00:00:16 Cleared
Tyler Fairbank
766853 - Moving Ocean Sunset Timelapse - 8K
766853 - Moving Ocean Sunset Timelapse - 8K
00:00:09 Cleared
Tyler Fairbank
767026 - Night Traffic Timelapse - Paris, France
767026 - Night Traffic Timelapse - Paris, France
00:00:04 Cleared
Tyler Fairbank
767029 - Paris Traffic Timelapse - Lion of Belfort
767029 - Paris Traffic Timelapse - Lion of Belfort
00:00:05 Cleared
Tyler Fairbank