Loading...
Search
> Stéphane Legrand00:00
00:00 / 00:00
Formentor, Spain, Timelapse - The shore of Formentor at Sunset
Clip ID 2125154
Creator Stéphane Legrand
Clearance
Proxy
Add to
Share
Add to Review Link
Select Your License
$ -
prores | 30fps | 3840x2160 | 976.70 MB
Per clip rates are for 20 seconds of final usage. If you are using more then 20 seconds or need a different file format or have questions about clearances contact us
Description
4K Timelapse Sequence of Formentor, Spain - The shore of Formentor at Sunset
Credits
Stéphane Legrand Photography
Keywords
time lapserocketwaynaturespainrockruraleyesunsunrisesummerbackgroundsroadsunsetviewlandscapetopmountainaerialseatimelapseoceanbeautifulbluewomanbackgroundofficeflagsceniccliffmountainsbeachseascapewildlifetime-lapsewaveswildcoastlineepicancientturquoiseshorecastleroadsmenorcacountyancient ruinscristallighthousemallorca
Related Footage
302861 - Milky way with clouds · 4K
302861 - Milky way with clouds · 4K
00:00:04 Cleared
Carlos Nomdedeu
302874 - Milky way stone · 4K
302874 - Milky way stone · 4K
00:00:08 Cleared
Carlos Nomdedeu
302885 - Milky way mountain · 4K
302885 - Milky way mountain · 4K
00:00:08 Cleared
Carlos Nomdedeu
987007 - Startrail over the mountains
987007 - Startrail over the mountains
00:00:10 Cleared
Night Lights Films
303020 - Night beach · 4K
303020 - Night beach · 4K
00:00:07 Cleared
Carlos Nomdedeu
737425 - sunny day sierra nevada spain ski resort lift and ride way 4k time lapse
737425 - sunny day sierra nevada spain ski resort lift and ride way 4k time lapse
00:00:04 Cleared
twodwork
750974 - sunny day sierra nevada spain ski resort lift and ride way 4k time lapse
750974 - sunny day sierra nevada spain ski resort lift and ride way 4k time lapse
00:00:08 Cleared
twodwork
987001 - Milky way rising over Tenerife's Caldera 1
987001 - Milky way rising over Tenerife's Caldera 1
00:00:10 Cleared
Night Lights Films