Loading...
Search
> Stéphane Legrand00:00
00:00 / 00:00
Paris, France, Timelapse - The Louvre museum in Paris from day to night
Clip ID 2151729
Creator Stéphane Legrand
Clearance
Proxy
Add to
Share
Add to Review Link
Select Your License
$ -
prores | 30fps | 7680x4320 | 6.08 GB
Per clip rates are for 20 seconds of final usage. If you are using more then 20 seconds or need a different file format or have questions about clearances contact us
Description
4K Timelapse Sequence of Paris, France - The Louvre Museum in Paris from day to night
Keywords
"parislouvretimelapsepyramidfranceglassmuseummonument4Kday to nightarchitectureartfamoussummersuneuropebackground peoplecolor imagecontemporarylouvre museumoutdoorreal timewalkingamusement parkartisticaugustbackgroundbacklightbeautifulblinkinglandmarkskycontrastdarkeveningferris wheelfrenchfull hdgiant wheelhdhotironlightsmodern artnightpassingpeoplesee-throughshades"
Related Footage
683330 - Louvre at night 04
683330 - Louvre at night 04
00:00:16 Not Cleared
Elmar Strotmann
616800 - Tourists at the Louvre Pyramid
616800 - Tourists at the Louvre Pyramid
00:00:21 Not Cleared
Grey Coast Media
616541 - Louvre and Glass Pyramid, Paris
616541 - Louvre and Glass Pyramid, Paris
00:00:17 Cleared
Grey Coast Media
616538 - View to the Louvre Museum and Glass Pyramid
616538 - View to the Louvre Museum and Glass Pyramid
00:00:20 Cleared
Grey Coast Media
2126299 - Time lapse from Louvre museum in Paris
2126299 - Time lapse from Louvre museum in Paris
00:00:08 Cleared
Niels Melander
616801 - Inside view of Louvre Pyramid
616801 - Inside view of Louvre Pyramid
00:00:14 Not Cleared
Grey Coast Media
616896 - Coming up to the Louvre Pyramid
616896 - Coming up to the Louvre Pyramid
00:00:42 Not Cleared
Grey Coast Media
616805 - Louvre visitors on escalators in the Pyramid hall
616805 - Louvre visitors on escalators in the Pyramid hall
00:00:19 Not Cleared
Grey Coast Media