Loading...
Search
> Stéphane Legrand00:00
00:00 / 00:00
Nice, France, Timelapse - The city traffic of the Promenade des Anglais boulevard in Nice at night
Clip ID 2151743
Creator Stéphane Legrand
Clearance
Proxy
Add to
Share
Add to Review Link
Select Your License
$ -
prores | 30fps | 7680x4320 | 5.82 GB
Per clip rates are for 20 seconds of final usage. If you are using more then 20 seconds or need a different file format or have questions about clearances contact us
Description
4K Timelapse Sequence of Nice, France - The city traffic of the Promenade des Anglais boulevard in Nice at night
Keywords
"nicepromenade des anglaistimelapsefrancefrenchviewbuildingeuropeeveningfamoushotel4Knightstreettourismtravelurbanbeachblueduskentranceeuropeanexpensivegorgeoushistoricaljulylandmarklandscapecityluxuryarchitecturemediterraneannationaloldpalmskysummersunnyvacationvintagewalking touristslightsmediterranean seapeopleroadchairfrench rivieracityscape"
Related Footage
2151751 - Nice, France, Timelapse - First person hyperlapse of the Promenade des Anglais boulevard in Nice dur
2151751 - Nice, France, Timelapse - First person hyperlapse of the Promenade des Anglais boulevard in Nice dur
00:00:24 Cleared
Stéphane Legrand
2153346 - Nice, France, Timelapse - The city of Nice and its iconic Promenade des Anglais from day to night
2153346 - Nice, France, Timelapse - The city of Nice and its iconic Promenade des Anglais from day to night
00:00:13 Cleared
Stéphane Legrand
2151724 - Nice, France, Timelapse - The Negresco palace beside the Promenade des Anglais in Nice at night
2151724 - Nice, France, Timelapse - The Negresco palace beside the Promenade des Anglais in Nice at night
00:00:14 Cleared
Stéphane Legrand
2151732 - Nice, France, Timelapse - First person hyperlapse of the Promenade des Anglais in Nice during a sunn
2151732 - Nice, France, Timelapse - First person hyperlapse of the Promenade des Anglais in Nice during a sunn
00:00:31 Cleared
Stéphane Legrand
2151755 - Nice, France, Timelapse - Wide angle view of the Palais de la Mediterranee beside the Promenade des
2151755 - Nice, France, Timelapse - Wide angle view of the Palais de la Mediterranee beside the Promenade des
00:00:07 Cleared
Stéphane Legrand
2151728 - Nice, France, Timelapse - The Palais de la Mediterranee beside the croisette in France at night
2151728 - Nice, France, Timelapse - The Palais de la Mediterranee beside the croisette in France at night
00:00:13 Cleared
Stéphane Legrand