Loading...
Search
> Stéphane Legrand00:00
00:00 / 00:00
Copenhagen, Denmark, Video - People walking at the Nyhavn Waterfront canal and entertainment distric
Clip ID 2156638
Creator Stéphane Legrand
Clearance
Proxy
Add to
Share
Add to Review Link
Select Your License
$ -
prores | 25fps | 3840x2160 | 2.23 GB
Per clip rates are for 20 seconds of final usage. If you are using more then 20 seconds or need a different file format or have questions about clearances contact us
Description
4K Video Sequence of Copenhagen, Denmark - People walking at the Nyhavn Waterfront canal and entertainment district lined by brightly coloured 17th and 18th-century townhouses during a sunny day
Keywords
"danishdenmarknyhavntime-lapsecopenhagentime lapseeuropecanaltravelarchitecturecapitalharborlandmarksunnytourismcityattractioneuropeanfacadeharbourjourneylandmarksreflectionscandinaviascenictowntripurban landscapewaterfrontblueboatbuildingcityscapecolorfulfamousoldseashipstreetsummertouristwatertouristiccapital citychurch towercity centerclouds movecopenhagen citydestinationdowntown"
Related Footage
975399 - Copenhagen Denmark Nyhavn New Harbour Day to Night Timelapse
975399 - Copenhagen Denmark Nyhavn New Harbour Day to Night Timelapse
00:00:20 Cleared
FIRSTLAPSE
812438 - boats in Nyhavn in Copenhagen
812438 - boats in Nyhavn in Copenhagen
00:00:12 Cleared
lennart
809334 - Nyhaven, Copenhagen
809334 - Nyhaven, Copenhagen
00:00:29 Cleared
lennart
601725 - Nyhavn in Denmark
601725 - Nyhavn in Denmark
00:00:18 Not Cleared
Aflo Motion
601727 - Nyhavn in Denmark
601727 - Nyhavn in Denmark
00:00:14 Cleared
Aflo Motion
601723 - Nyhavn in Denmark
601723 - Nyhavn in Denmark
00:00:14 Not Cleared
Aflo Motion
601726 - Nyhavn in Denmark
601726 - Nyhavn in Denmark
00:00:27 Cleared
Aflo Motion
2156668 - Copenhagen, Denmark, Video - People chilling at The Nyhavn Waterfront canal and entertainment distri
2156668 - Copenhagen, Denmark, Video - People chilling at The Nyhavn Waterfront canal and entertainment distri
00:00:10 Cleared
Stéphane Legrand