Search
> Clarence Holmes00:00
00:00 / 00:00
Tappan Zee Bridge Timelapse 2
Clip ID 340066
Creator Clarence Holmes
Clearance
Proxy
Add to
Share
Add to Review Link
Select Your License
$ -
mjpeg | 29.970fps | 1920x1080 | 203.04 MB
Per clip rates are for 20 seconds of final usage. If you are using more then 20 seconds or need a different file format or have questions about clearances contact us
Description
Timelapse sequence of the Tappan Zee Bridge, spanning the Hudson River from Westchester County to Rockland County, New York, with morning traffic and clouds rolling over in winter, with snow visible from Winter Storm Nemo.
Credits
Clarence Holmes
Keywords
1080pAmericaHudson RiverHudson ValleyNew YorkNorth AmericaRockland CountyTappan ZeeTarrytownUSUSAUnited StatesWestchester Countyautomobilesbridgecantilever bridgecarscloudcloudscommutingdaylightdaytimegovernor malcolm wilsonhighwayinfrastructurelock downmorningpalisadesskysnowthruwaytime-lapsetimelapsetraffictransportvehicleswaterwintertime
Related Footage

339728 - Lower Manhattan Skyline 1
339728 - Lower Manhattan Skyline 1
00:00:15 Cleared
Clarence Holmes
191223 - Taxi Driver NYC
191223 - Taxi Driver NYC
00:00:04 Cleared
VideoTrekker Films

339737 - New York Water Taxi 2
339737 - New York Water Taxi 2
00:00:15 Not Cleared
Clarence Holmes

339730 - New York Water Taxi 1
339730 - New York Water Taxi 1
00:00:13 Not Cleared
Clarence Holmes

339856 - Sailing under the Bronx-Whitestone Bridge
339856 - Sailing under the Bronx-Whitestone Bridge
00:00:14 Cleared
Clarence Holmes

339855 - Sailboats on the Hudson River 1
339855 - Sailboats on the Hudson River 1
00:00:15 Not Cleared
Clarence Holmes

339781 - George Washington Bridge Traffic 4
339781 - George Washington Bridge Traffic 4
00:00:17 Cleared
Clarence Holmes

337242 - New York City Sunrise Timelapse 2
337242 - New York City Sunrise Timelapse 2
00:00:19 Cleared
Clarence Holmes