Loading...
Search
> Stéphane Legrand00:00
00:00 / 00:00
Toronto, Canada - Timelapse - Nathan Phillips Square
Clip ID 631731
Creator Stéphane Legrand
Clearance
Proxy
Add to
Share
Add to Review Link
Select Your License
$ -
prores | 25fps | 4096x2304 | 1.65 GB
Per clip rates are for 20 seconds of final usage. If you are using more then 20 seconds or need a different file format or have questions about clearances contact us
Description
4K Timelapse Sequence of Toronto, Canada - Nathan Phillips Square
Credits
Stéphane Legrand Photography
Keywords
4kanglearchesarchitectureartbluebuildingcanadacanadiancentercentrecitycity hallcityscapecloudcloudyconcertscouncilcurveddaydestinationdowntownexhibitionfountaingtahallhighrisehotlandmarklunchmayormodernnathannathan phillips squarenewoldontariooutdoorovalpeoplephillipspoolreflectionrelaxsellshowsightsightseeingskyskyscrapersquarestrollsummersunsunnytentstorontotourtourismtowertowntravelurbanvacationwalkwaterwidewide angle
Related Footage
84079 - Tracking time lapse under two stone arches
84079 - Tracking time lapse under two stone arches
00:00:05 Cleared
Creative Media Group/Stock Footage, Inc.
84083 - Tracking time lapse under stone arches
84083 - Tracking time lapse under stone arches
00:00:07 Cleared
Creative Media Group/Stock Footage, Inc.
84080 - Tracking time lapse under stone arches. Cropped.
84080 - Tracking time lapse under stone arches. Cropped.
00:00:07 Cleared
Creative Media Group/Stock Footage, Inc.
84081 - Panning shot of Tracking time lapse under stone arches
84081 - Panning shot of Tracking time lapse under stone arches
00:00:07 Cleared
Creative Media Group/Stock Footage, Inc.
90714 - Close pan of arches in Roman Colosseum
90714 - Close pan of arches in Roman Colosseum
00:00:29 Cleared
Creative Media Group/Stock Footage, Inc.
2086406 - 593088929 / Arches National Park / Utah / USA
2086406 - 593088929 / Arches National Park / Utah / USA
00:00:05 Clearance Not Needed
fp-1456
1115535 - Panning Timelapse Left to Right of Federal Triangle Archways with Shadows
1115535 - Panning Timelapse Left to Right of Federal Triangle Archways with Shadows
00:00:10 Cleared
Framework Films
2114389 - 542683014 / People / Cycling / Arches
2114389 - 542683014 / People / Cycling / Arches
00:00:30 Not Cleared
fp-1474