Loading...
Search
> Stéphane Legrand00:00
00:00 / 00:00
Taipei, Taiwan, Timelapse - Downtown's Taipei Before the Sunset
Clip ID 990783
Creator Stéphane Legrand
Clearance
Proxy
Add to
Share
Add to Review Link
Select Your License
$ -
prores | 30fps | 3840x2160 | 707.93 MB
Per clip rates are for 20 seconds of final usage. If you are using more then 20 seconds or need a different file format or have questions about clearances contact us
Description
4K Timelapse Sequence of Taipei, Taiwan - Downtown's Taipei Before the Sunset
Credits
Stéphane Legrand Photography
Keywords
taipeiskylinetaiwanskycityscapecityviewdowntownbluesunsetbusinessbuildingasiatravelurbanscenesunnyscenicsceneryfamousskyscraperdaytimebeautifulbackgroundwhitelightlandscapearchitectureoutdoorstourismlandmarkchineseeveningchinamodernnaturebeautyoutdoortraditionalcultureasian4ktimelapsetime-lapsetimelapse
Related Footage
336836 - Taipei 101 Cityscape with a Stormy Sky
336836 - Taipei 101 Cityscape with a Stormy Sky
00:00:10 Cleared
Jared Cook
350572 - Taipei 101 on a Stormy Afternoon
350572 - Taipei 101 on a Stormy Afternoon
00:00:10 Cleared
Jared Cook
350582 - Downtown Taipei on a Stormy Afternoon
350582 - Downtown Taipei on a Stormy Afternoon
00:00:14 Cleared
Jared Cook
350591 - Downtown Taipei on a Stormy Afternoon
350591 - Downtown Taipei on a Stormy Afternoon
00:00:08 Cleared
Jared Cook
350562 - Taipei 101 on a Stormy Afternoon
350562 - Taipei 101 on a Stormy Afternoon
00:00:14 Cleared
Jared Cook
390835 - Taipei 101 and Cityscape
390835 - Taipei 101 and Cityscape
00:00:06 Cleared
Jared Cook
350596 - Taipei 101 on a Stormy Afternoon
350596 - Taipei 101 on a Stormy Afternoon
00:00:23 Cleared
Jared Cook
350620 - Taipei 101 on a Stormy Afternoon
350620 - Taipei 101 on a Stormy Afternoon
00:00:20 Cleared
Jared Cook